Proteintech, 83860-1-RR, FXYD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The FXYD2 (83860-1-RR) by Proteintech is a Recombinant antibody targeting FXYD2 in WB, FC (Intra), ELISA applications with reactivity to human samples 83860-1-RR targets FXYD2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human kidney tissue Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information FXYD2 (FXYD domain-containing ion transport regulator 2), also known as the gamma-subunit of the NaK-ATPase, belongs to the FXYD family which has been proposed to be the regulators of Na, K-ATPase function by lowering affinities of the system for potassium and sodium. The expression of FXYD2 is most abundant in kidney, while it is also detected in several other tissues like placenta, pancreas, and dorsal root ganglia (DRGs). Three splice variants of FXYD2 have been reported in mouse kidney, namely FXYD2 γa, -γb,and -γc. FXYD2 γa has been identified as a pancreatic beta cell-specific biomarker. This antibody can recognize all three isoforms of FXYD2. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34030 Product name: Recombinant human FXYD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC013289 Sequence: MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP* Predict reactive species Full Name: FXYD domain containing ion transport regulator 2 Calculated Molecular Weight: 7 kDa Observed Molecular Weight: 7-10 kDa GenBank Accession Number: BC013289 Gene Symbol: FXYD2 Gene ID (NCBI): 486 RRID: AB_3671444 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P54710 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.