Iright
BRAND / VENDOR: Proteintech

Proteintech, 83870-1-RR, UCP1 Recombinant monoclonal antibody

CATALOG NUMBER: 83870-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The UCP1 (83870-1-RR) by Proteintech is a Recombinant antibody targeting UCP1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 83870-1-RR targets UCP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brown adipose tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brown adipose tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information UCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20388 Product name: Recombinant human UCP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-307 aa of BC098168 Sequence: MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT Predict reactive species Full Name: uncoupling protein 1 (mitochondrial, proton carrier) Calculated Molecular Weight: 307 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC098168 Gene Symbol: UCP1 Gene ID (NCBI): 7350 RRID: AB_3671456 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P25874 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924