Proteintech, 83884-3-RR, CD40L/CD154 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD40L/CD154 (83884-3-RR) by Proteintech is a Recombinant antibody targeting CD40L/CD154 in WB, ELISA applications with reactivity to mouse, rat samples 83884-3-RR targets CD40L/CD154 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: J774A.1 cells, rat spleen tissue, CTLL-2 cells, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:18000 Background Information The CD40 ligand (CD40L, TRAP, CD154), a member of the TNF superfamily of ligands, is expressed as either a 33 kDa transmembrane homologue or an 18 kDa soluble form (sCD154). CD40L is primarily expressed on activated CD4+ T cells and a small proportion of CD8+ T cells and platelets. It binds to CD40 on antigen-presenting cells (APC), which leads to many effects depending on the target cell type. Recent studies have suggested that CD40/CD40L interactions regulate oxidative stress and affect various signaling pathways in both the immunological and the cardiovascular systems. The CD40/CD40L system is also involved in tumorigenesis. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0990 Product name: Recombinant Mouse CD40 Ligand/TNFSF5 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-His Domain: 115-260 aa of NM_011616.2 Sequence: GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL Predict reactive species Full Name: CD40 ligand Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: NM_011616.2 Gene Symbol: CD154 Gene ID (NCBI): 21947 RRID: AB_3671466 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P27548 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.