Iright
BRAND / VENDOR: Proteintech

Proteintech, 83886-6-RR, CSDC2 Recombinant monoclonal antibody

CATALOG NUMBER: 83886-6-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CSDC2 (83886-6-RR) by Proteintech is a Recombinant antibody targeting CSDC2 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83886-6-RR targets CSDC2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: U-2 OS Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PIPPIN, also known as CSDC2 (Cold shock domain-containing protein C2) is an RNA‐binding protein (RBP), highly enriched in the rat brain, specifically enriched in some pyramidal neurons of the cerebral cortex and in the Purkinje cells of the cerebellum (PMID: 10446180). PIPPIN has the potential to undergo different posttranslational modifications and might be a good candidate to regulate the synthesis of specific proteins in response to extracellular stimuli. Nuclear CSDC2 is connected to proliferation and cytoplasmic CSDC2 to terminal differentiation in the decidua and that CSDC2 could regulate differentiation during decidua development (PMID: 30078185, PMID: 17053029). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16216 Product name: Recombinant human CSDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC067113 Sequence: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEG Predict reactive species Full Name: cold shock domain containing C2, RNA binding Calculated Molecular Weight: 153 aa, 17 kDa GenBank Accession Number: BC067113 Gene Symbol: CSDC2 Gene ID (NCBI): 27254 RRID: AB_3671469 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9Y534 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924