Iright
BRAND / VENDOR: Proteintech

Proteintech, 83891-6-RR, ETV4 Recombinant monoclonal antibody

CATALOG NUMBER: 83891-6-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ETV4 (83891-6-RR) by Proteintech is a Recombinant antibody targeting ETV4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83891-6-RR targets ETV4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Positive IHC detected in: human colon cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ETS translocation variant 4 (ETV4), also named as E1A-F or PEA3, is 484 amino acid protein, which contains one ETS DNA-binding domain and belongs to the ETS family. The calculated molecular weight of ETV4 protein is 54 kDa, but the phosphorylated ETV4 is a 54-61 kDa protein. ETV4 as a transcription activator localizes in the nucleus and binds to the enhancer of the adenovirus E1A gene. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0984 Product name: Recombinant human ETV4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC007242 Sequence: MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY Predict reactive species Full Name: ets variant 4 Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 61-65 kDa GenBank Accession Number: BC007242 Gene Symbol: ETV4 Gene ID (NCBI): 2118 RRID: AB_3671474 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P43268 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924