Proteintech, 83937-3-RR, CXCL1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CXCL1 (83937-3-RR) by Proteintech is a Recombinant antibody targeting CXCL1 in WB, ELISA applications with reactivity to human samples 83937-3-RR targets CXCL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2917 Product name: Recombinant human CXCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC011976 Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN Predict reactive species Full Name: chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) Calculated Molecular Weight: 8 kDa to 14 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC011976 Gene Symbol: CXCL1 Gene ID (NCBI): 2919 RRID: AB_3671519 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P09341 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.