Iright
BRAND / VENDOR: Proteintech

Proteintech, 83944-1-RR, TOB1 Recombinant monoclonal antibody

CATALOG NUMBER: 83944-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TOB1 (83944-1-RR) by Proteintech is a Recombinant antibody targeting TOB1 in WB, ELISA applications with reactivity to human samples 83944-1-RR targets TOB1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HEK-293T cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information TOB1, also known as APRO6 or TROB1, is a member of the transducer of erbB-2/B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The TOB1 protein has a large additional C-terminal region, which contains PAM2 motifs that mediate interactions with poly(A)-binding proteins. It is mainly located in the cell nucleus and will transfer between the cell nucleus and the cytoplasm. The more phosphorylation, the more obvious the cytoplasmic localization.The predicted MW of this protein is 38 kDa. Catalog#83944-1-RR recognises 38 and 45 kDa band, and the additional 45 kDa band may be due to phosphorylation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6714 Product name: Recombinant human TOB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC031406 Sequence: MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN Predict reactive species Full Name: transducer of ERBB2, 1 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38-45 kDa GenBank Accession Number: BC031406 Gene Symbol: TOB1 Gene ID (NCBI): 10140 RRID: AB_3671523 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P50616 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924