Proteintech, 83944-2-RR, TOB1 Recombinant monoclonal antibody

Size: 20ul / 100ul The TOB1 (83944-2-RR) by Proteintech is a Recombinant antibody targeting TOB1 in IHC, IF/ICC, ELISA applications with reactivity to human samples 83944-2-RR targets TOB1 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TOB1, also known as APRO6 or TROB1, is a member of the transducer of erbB-2/B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The TOB1 protein has a large additional C-terminal region, which contains PAM2 motifs that mediate interactions with poly(A)-binding proteins. It is mainly located in the cell nucleus and will transfer between the cell nucleus and the cytoplasm. The more phosphorylation, the more obvious the cytoplasmic localization. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6714 Product name: Recombinant human TOB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC031406 Sequence: MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN Predict reactive species Full Name: transducer of ERBB2, 1 Calculated Molecular Weight: 38 kDa GenBank Accession Number: BC031406 Gene Symbol: TOB1 Gene ID (NCBI): 10140 RRID: AB_3671524 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P50616 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.