Iright
BRAND / VENDOR: Proteintech

Proteintech, 83960-3-RR, SQRDL Recombinant monoclonal antibody

CATALOG NUMBER: 83960-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SQRDL (83960-3-RR) by Proteintech is a Recombinant antibody targeting SQRDL in WB, ELISA applications with reactivity to human samples 83960-3-RR targets SQRDL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, A549 cells, HT-29 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10762 Product name: Recombinant human SQRDL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-450 aa of BC016836 Sequence: GRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS Predict reactive species Full Name: sulfide quinone reductase-like (yeast) Calculated Molecular Weight: 450 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC016836 Gene Symbol: SQRDL Gene ID (NCBI): 58472 RRID: AB_3671539 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6N5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924