Iright
BRAND / VENDOR: Proteintech

Proteintech, 83976-3-RR, CDK7 Recombinant monoclonal antibody

CATALOG NUMBER: 83976-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CDK7 (83976-3-RR) by Proteintech is a Recombinant antibody targeting CDK7 in WB, IF/ICC, ELISA applications with reactivity to human samples 83976-3-RR targets CDK7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25737 Product name: Recombinant human CDK7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 183-345 aa of BC005298 Sequence: LLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI Predict reactive species Full Name: cyclin-dependent kinase 7 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC005298 Gene Symbol: CDK7 Gene ID (NCBI): 1022 RRID: AB_3671551 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P50613 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924