Proteintech, 83989-4-RR, TPRG1L Recombinant monoclonal antibody

Size: 20ul / 100ul The TPRG1L (83989-4-RR) by Proteintech is a Recombinant antibody targeting TPRG1L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 83989-4-RR targets TPRG1L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TPRG1L (Tumor protein p63-regulated gene 1-like protein) belongs to the presynaptic protein involved in the synaptic transmission tuning. It can regulate synaptic release probability by decreasing the calcium sensitivity of release. TPRG1L has two isoforms with molecular weights of 30kd and 23kd respectively. This antibody can recognize the 30kd isoform and may also recognize the 23kd isoform. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22585 Product name: Recombinant human TPRG1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC019034 Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEREGFGIRIQWDKQSRPSFI Predict reactive species Full Name: tumor protein p63 regulated 1-like Observed Molecular Weight: 31 kDa GenBank Accession Number: BC019034 Gene Symbol: TPRG1L Gene ID (NCBI): 127262 RRID: AB_3671565 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q5T0D9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.