Iright
BRAND / VENDOR: Proteintech

Proteintech, 84007-5-RR, EXOC1 Recombinant monoclonal antibody

CATALOG NUMBER: 84007-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EXOC1 (84007-5-RR) by Proteintech is a Recombinant antibody targeting EXOC1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 84007-5-RR targets EXOC1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, C1C12 cells, rat brain tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:300-1:1200 Background Information EXOC1 (exocyst complex component 1), also known as SEC3, is a component of the exocyst complex which is essential for the targeting of exocytic vesicles to specific docking sites on the plasma membrane. The exocyst complex is an octameric complex that tethers vesicles at the plasma membrane, regulates polarized exocytosis, and recruits membranes and proteins required for nanotube formation.Recently it has been reported that exocyst complex proteins are likely a key effector of Nef-mediated enhancement of nanotube formation, and possibly microvesicle secretion, which suggests a new paradigm of exocyst involvement in polarized targeting for intercellular transfer of viral proteins and viruses. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2303 Product name: Recombinant human EXOC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-488 aa of BC020650 Sequence: MPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH Predict reactive species Full Name: exocyst complex component 1 Calculated Molecular Weight: 894 aa, 102 kDa Observed Molecular Weight: 102 kDa GenBank Accession Number: BC020650 Gene Symbol: EXOC1 Gene ID (NCBI): 55763 RRID: AB_3671576 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NV70 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924