Iright
BRAND / VENDOR: Proteintech

Proteintech, 84020-3-RR, FOXF1 Recombinant monoclonal antibody

CATALOG NUMBER: 84020-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FOXF1 (84020-3-RR) by Proteintech is a Recombinant antibody targeting FOXF1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84020-3-RR targets FOXF1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information FOXF1 (Forkhead box protein F1), also known as FKHL5, It is expected to be located in the nucleus, which is expressed predominantly in lung and placenta. FOXF1, a member of the Forkhead box family of transcription factors, as one of the most highly and consistently upregulated genes in FP-RMS. While it is known that FOXF1 is required for mesodermal differentiation toward endothelial and smooth muscle cell lineages, FOXF1 is not expressed in differentiated skeletal muscle cells, and its role in fusion-positive FP-RMS remains unknown (PMID: 33627785). The molecular weight of FOXF1 is 40 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34266 Product name: Recombinant human FOXF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-379 aa of NP_001442 Sequence: MYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCVM Predict reactive species Full Name: forkhead box F1 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NP_001442 Gene Symbol: FOXF1 Gene ID (NCBI): 2294 RRID: AB_3671589 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q12946 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924