Iright
BRAND / VENDOR: Proteintech

Proteintech, 84056-6-RR, Calsequestrin 2 Recombinant monoclonal antibody

CATALOG NUMBER: 84056-6-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Calsequestrin 2 (84056-6-RR) by Proteintech is a Recombinant antibody targeting Calsequestrin 2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples 84056-6-RR targets Calsequestrin 2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: human heart tissue, mouse heart tissue, rat heart tissue, pig heart tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C2C12 cells Positive FC (Intra) detected in: U2OS cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Calsequestrin (CASQ) is a Ca2+-binding protein present primarily in junctional sarcoplasmic reticulum of skeletal and cardiac muscle; the cardiac form (CASQ2) is encoded by a separate gene. The primary role of CASQ2 is buffering of the sarcoplasmic reticulum Ca2+ ions, but another role for CASQ2 has emerged recently: CASQ2 regulates the open probability of ryanodine receptor 2 (RyR2). Mutations in CASQ2 cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33584 Product name: Recombinant human CASQ2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-399 aa of BC022288 Sequence: MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE* Predict reactive species Full Name: calsequestrin 2 (cardiac muscle) Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46-55 kDa GenBank Accession Number: BC022288 Gene Symbol: Calsequestrin 2 Gene ID (NCBI): 845 RRID: AB_3671624 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O14958 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924