Iright
BRAND / VENDOR: Proteintech

Proteintech, 84121-5-RR, ZNF350 Recombinant monoclonal antibody

CATALOG NUMBER: 84121-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ZNF350 (84121-5-RR) by Proteintech is a Recombinant antibody targeting ZNF350 in WB, FC (Intra), ELISA applications with reactivity to human samples 84121-5-RR targets ZNF350 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ZNF350 (Zinc finger protein 350), also known as zinc-finger and BRCA1-interacting protein with a Kruppel-associated box (KRAB) domain (ZBRK1), is involved in the development of several human tumor types, including breast, colon, and cervical carcinomas. ZNF350 has been identified as a transcriptional suppressor that can either form complexes with other proteins or play a direct transcriptional suppressive role in a single-factor form (PMID: 30613364). Overexpression of ZBRK1 has the potential to inhibit cancer cell migration and suppress metastasis activity suggesting that ZBRK1 may behave as a metastasis suppressor (PMID: 19996286). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23982 Product name: Recombinant human ZNF350 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 426-532 aa of BC009921 Sequence: REKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP Predict reactive species Full Name: zinc finger protein 350 Observed Molecular Weight: 60 kDa GenBank Accession Number: BC009921 Gene Symbol: ZNF350 Gene ID (NCBI): 59348 RRID: AB_3671683 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9GZX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924