Proteintech, 84148-6-RR, IMUP Recombinant monoclonal antibody

Size: 20ul / 100ul The IMUP (84148-6-RR) by Proteintech is a Recombinant antibody targeting IMUP in IHC, IF/ICC, ELISA applications with reactivity to human samples 84148-6-RR targets IMUP in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Immortalization up-regulated protein (IMUP), also known as C19orf33 or H2RSP, was first identified in SV40-immortalized fibroblasts and includes two isoforms, IMUP-1 and IMUP-2 (PMID: 14981917; 35142956). It is found primarily in the nucleus (PMID: 11606055). IMUP is reportedly upregulated in many cancer cells and tissues and its overexpression is associated with tumorigenicity and cell-cycle acceleration (PMID: 16962562; 35142956; 22886722). The apparent molecular determined by SDS-PAGE might be due to post-translational modifications or anomalous migration behavior (PMID: 11080599). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22218 Product name: Recombinant human C19orf33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC060319 Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM Predict reactive species Full Name: chromosome 19 open reading frame 33 Calculated Molecular Weight: 106 aa, 11 kDa GenBank Accession Number: BC060319 Gene Symbol: IMUP Gene ID (NCBI): 64073 RRID: AB_3671711 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9GZP8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.