Proteintech, 84160-3-RR, GPNMB Recombinant monoclonal antibody

Size: 20ul / 100ul The GPNMB (84160-3-RR) by Proteintech is a Recombinant antibody targeting GPNMB in WB, IF/ICC, ELISA applications with reactivity to human samples 84160-3-RR targets GPNMB in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, THP-1 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GPNMB also known as HGFIN, osteoactivin, and DC-HIL, is a type I membrane glycoprotein involved in various biological processes, including inflammation, invasion and metastasis of malignant tumors, cell differentiation, and tissue regeneration. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB acts as an osteogenic factor that stimulates osteoblast differentiation in vivo and in vitro. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14124 Product name: Recombinant human GPNMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-181 aa of BC011595 Sequence: AKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLG Predict reactive species Full Name: glycoprotein (transmembrane) nmb Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 120 kDa, 95 kDa GenBank Accession Number: BC011595 Gene Symbol: GPNMB Gene ID (NCBI): 10457 RRID: AB_3671722 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14956 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.