Proteintech, 84194-6-RR, ATAD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ATAD1 (84194-6-RR) by Proteintech is a Recombinant antibody targeting ATAD1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 84194-6-RR targets ATAD1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, A549 cells, Jurkat cells, HeLa cells, HepG2 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The mitochondrial AAA (ATPase Associated with diverse cellular Activities) protein ATAD1 (in humans; Msp1 in yeast) removes mislocalized membrane proteins, as well as stuck import substrates from the mitochondrial outer membrane, facilitating their re-insertion into their cognate organelles and maintaining mitochondria's protein import capacity. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10343 Product name: Recombinant human ATAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 164-361 aa of BC010868 Sequence: DKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD Predict reactive species Full Name: ATPase family, AAA domain containing 1 Calculated Molecular Weight: 361 aa, 41 kDa Observed Molecular Weight: 32-37 kDa GenBank Accession Number: BC010868 Gene Symbol: ATAD1 Gene ID (NCBI): 84896 RRID: AB_3671746 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8NBU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.