Iright
BRAND / VENDOR: Proteintech

Proteintech, 84216-1-RR, MIER2 Recombinant monoclonal antibody

CATALOG NUMBER: 84216-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MIER2 (84216-1-RR) by Proteintech is a Recombinant antibody targeting MIER2 in WB, IF/ICC, ELISA applications with reactivity to human samples 84216-1-RR targets MIER2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, HEK-293 cells, Jurkat cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Mesoderm induction early response 2 (MIER2) is a member of the MIER family of proteins, which is relatively conservative in evolution and includes three members: MIER1, MIER2, and MIER3. The MIER family is known to contribute to histone deacetylase (HDAC) activity and actively participate in histone deacetylation (PMID: 28046085; PMID: 38702028). In renal cell carcinoma, MIER2 represses PGC1A expression by recruiting HDAC1 to deacetylate P53 (PMID: 28046085). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11491 Product name: Recombinant human MIER2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 197-545 aa of BC028203 Sequence: IMVGPQFQADLSNLHLNRHCEKIYENEDQLLWDPSVLPEREVEEFLYRAVKRRWHEMAGPQLPEGEAVKDSEQALYELVKCNFNVEEALRRLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERYDYFAQQTRLGRRKYVPSGTTDADQDLDGSDPDGPGRPRPEQDTLTGMRTDPLSVDGTAGGLDEPGVASDGLPSSEPGPCSFQQLDESPAVPLSHRPPALADPASYQPAVTAPEPDASPRLAVDFALPKELPLISSHVDLSGDPEETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMTC Predict reactive species Full Name: mesoderm induction early response 1, family member 2 Calculated Molecular Weight: 545 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC028203 Gene Symbol: MIER2 Gene ID (NCBI): 54531 RRID: AB_3671772 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N344 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924