Iright
BRAND / VENDOR: Proteintech

Proteintech, 84218-1-RR, CPN1 Recombinant monoclonal antibody

CATALOG NUMBER: 84218-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CPN1 (84218-1-RR) by Proteintech is a Recombinant antibody targeting CPN1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 84218-1-RR targets CPN1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:125-1:500 Background Information Human carboxypeptidase N (CPN), a member of the CPN/E subfamily of "regulatory" metallo-carboxypeptidases, is an extracellular glycoprotein synthesized in the liver and secreted into the blood, where it controls the activity of vasoactive peptide hormones, growth factors and cytokines by specifically removing C-terminal basic residues. Normally, CPN circulates in blood plasma as a hetero-tetramer consisting of two 83 kDa (CPN2) domains each flanked by a 48 to 55 kDa catalytic (CPN1) domain. The C terminal region of the CPN1 subunit differs from all other family members in that it contains numerous basic residues. Proteolysis at these sites apparently happens either constitutively in the blood or during processing and secretion from the liver. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4035 Product name: Recombinant human CPN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-458 aa of BC027897 Sequence: RNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA Predict reactive species Full Name: carboxypeptidase N, polypeptide 1 Calculated Molecular Weight: 458 aa, 52 kDa Observed Molecular Weight: 40~50 kDa GenBank Accession Number: BC027897 Gene Symbol: CPN1 Gene ID (NCBI): 1369 RRID: AB_3671774 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15169 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924