Iright
BRAND / VENDOR: Proteintech

Proteintech, 84231-4-RR, TNIK Recombinant monoclonal antibody

CATALOG NUMBER: 84231-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TNIK (84231-4-RR) by Proteintech is a Recombinant antibody targeting TNIK in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84231-4-RR targets TNIK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: T-47D cells, HeLa cells, HEK-293 cells, K-562 cells, COLO 205 cells, Caco-2 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information TNIK (Traf2- and Nck-interacting kinase) is one of the germinal center kinase family members involved in cytoskeleton organization and neuronal dendrite extension, which had been implicated in postsynaptic signaling as well as in regulation of cell proliferation. TNiK is expressed in the nervous system and plays key roles at the synapse and nucleus, In non-neuronal cells, TNiK has been described as a critical component of transcriptional regulatory mechanisms, mediated by Wnt signaling (PMID: 24566388). TNIK is also an essential regulatory component of the T-cell factor-4 and β-catenin transcriptional complex and is required for the tumor-initiating function of colorectal cancer stem cells (PMID: 10521462). Western blot analysis detected TNIK at an apparent molecular mass of 150~180 kDa as cited in literature (PMID: 24566388). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34132 Product name: Recombinant human TNIK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 585-636 aa of BC150256 Sequence: LRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMP Predict reactive species Full Name: TRAF2 and NCK interacting kinase Observed Molecular Weight: 155~180 kDa GenBank Accession Number: BC150256 Gene Symbol: TNIK Gene ID (NCBI): 23043 RRID: AB_3671785 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UKE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924