Iright
BRAND / VENDOR: Proteintech

Proteintech, 84297-1-RR, Beta TRCP Recombinant monoclonal antibody

CATALOG NUMBER: 84297-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Beta TRCP (84297-1-RR) by Proteintech is a Recombinant antibody targeting Beta TRCP in IF/ICC, ELISA applications with reactivity to human samples 84297-1-RR targets Beta TRCP in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: MCF-7 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28739 Product name: Recombinant human BETA-TRCP,BTRC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 308-605 aa of BC027994 Sequence: CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR Predict reactive species Full Name: beta-transducin repeat containing Calculated Molecular Weight: 605 aa, 69 kDa GenBank Accession Number: BC027994 Gene Symbol: Beta TRCP Gene ID (NCBI): 8945 RRID: AB_3671838 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9Y297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924