Iright
BRAND / VENDOR: Proteintech

Proteintech, 84306-3-RR, MAP2 Recombinant monoclonal antibody

CATALOG NUMBER: 84306-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MAP2 (84306-3-RR) by Proteintech is a Recombinant antibody targeting MAP2 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 84306-3-RR targets MAP2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Positive IF-Fro detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:125-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information MAP2 (microtubule-associated protein 2) is a cytoskeleton protein abundant in the brain and has an important role in neuronal morphogenesis. Multiple high MW and low MW MAP2 isoforms are expressed within the proximal segment of axons, dendrites, and cell bodies. The expression of MAP2 is regulated in both a tissue- and developmentally-specific manner. The 280 kDa MAP2B is present throughout rat brain development, and the slightly larger MAP2A appears first during the end of the second week of postnatal life. MAP2C, composed of several bands of about 70 kDa, is present during early brain development and largely disappears from the mature brain except for the retina, olfactory bulb, and cerebellum. In addition, some isoforms with lower MW around 50-60 kDa also exist. MAP2 antibodies have been widely used to mark the neuron or dendrite formation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11580 Product name: Recombinant human MAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 213-559 aa of BC038857 Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL Predict reactive species Full Name: microtubule-associated protein 2 Calculated Molecular Weight: 200 kDa Observed Molecular Weight: 280-300 kDa, 70-85 kDa GenBank Accession Number: BC038857 Gene Symbol: MAP2 Gene ID (NCBI): 4133 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11137 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924