Iright
BRAND / VENDOR: Proteintech

Proteintech, 84331-4-RR, RAPGEF2 Recombinant monoclonal antibody

CATALOG NUMBER: 84331-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RAPGEF2 (84331-4-RR) by Proteintech is a Recombinant antibody targeting RAPGEF2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 84331-4-RR targets RAPGEF2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells, Jurkat cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35288 Product name: Recombinant human RAPGEF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1255-1400 aa of NM_014247.2 Sequence: GSHDNIQTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP Predict reactive species Full Name: Rap guanine nucleotide exchange factor (GEF) 2 Calculated Molecular Weight: 167kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: NM_014247.2 Gene Symbol: RAPGEF2 Gene ID (NCBI): 9693 RRID: AB_3671872 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9Y4G8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924