Iright
BRAND / VENDOR: Proteintech

Proteintech, 84346-4-RR, EXOSC6 Recombinant monoclonal antibody

CATALOG NUMBER: 84346-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EXOSC6 (84346-4-RR) by Proteintech is a Recombinant antibody targeting EXOSC6 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84346-4-RR targets EXOSC6 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, MCF-7 cells, HaCat cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information EXOSC6 (exosome component 6), also known as p11 or MTR3. The calculated molecular weight of EXOSC6 is 28 kDa. And it has low tissue specificity. The gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. It is also a component of the RNA exosome complex (PMID: 29906447). The composition of human exosome is similar to its yeast counterpart. EXOSC6 is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33513 Product name: Recombinant human EXOSC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of NM_058219 Sequence: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP Predict reactive species Full Name: exosome component 6 Calculated Molecular Weight: 28kd Observed Molecular Weight: 28-32 kDa GenBank Accession Number: NM_058219 Gene Symbol: EXOSC6 Gene ID (NCBI): 118460 RRID: AB_3671887 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q5RKV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924