Iright
BRAND / VENDOR: Proteintech

Proteintech, 84361-2-RR, Placental lactogen Recombinant monoclonal antibody

CATALOG NUMBER: 84361-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Placental lactogen (84361-2-RR) by Proteintech is a Recombinant antibody targeting Placental lactogen in WB, IHC, ELISA applications with reactivity to human samples 84361-2-RR targets Placental lactogen in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Chorionic somatomammotropin hormone 1 (placental lactogen, CSH1), is a hormone with the molecular weight of 25 kDa. The data suggest that this protein may link with the Silver-Russell syndrome (SRS), a disease of pre- and postnatal growth restriction and a characteristic small, triangular face. SRS is also accompanied by other dysmorphic features including fifth finger clinodactyly and skeletal asymmetry. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0201 Product name: Recombinant human CSH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-207 aa of BC002717 Sequence: RTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQ Predict reactive species Full Name: chorionic somatomammotropin hormone 1 (placental lactogen) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC002717 Gene Symbol: CSH1 Gene ID (NCBI): 1442 RRID: AB_3671899 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P0DML2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924