Iright
BRAND / VENDOR: Proteintech

Proteintech, 84376-4-RR, GADD45A Recombinant monoclonal antibody

CATALOG NUMBER: 84376-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GADD45A (84376-4-RR) by Proteintech is a Recombinant antibody targeting GADD45A in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 84376-4-RR targets GADD45A in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, NIH/3T3 cells Positive FC (Intra) detected in: U-2 OS, K562 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GADD45A, also named as DDIT1 and GADD45, belongs to the GADD45 family. It binds to proliferating cell nuclear antigen. GADD45A may affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. GADD45A plays an essential role in active DNA demethylation during terminal osteogenic differentiation of adipose-derived mesenchymal stem cells. GADD45A has Dimer (~28-36 kDa) and Monomer (14-18 kDa) forms (PMID:11498536). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4687 Product name: Recombinant human GADD45A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-165 aa of BC011757 Sequence: EFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER Predict reactive species Full Name: growth arrest and DNA-damage-inducible, alpha Calculated Molecular Weight: 165 aa, 18 kDa Observed Molecular Weight: 14-18 kDa, 28-36 kDa GenBank Accession Number: BC011757 Gene Symbol: GADD45A Gene ID (NCBI): 1647 RRID: AB_3671913 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P24522 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924