Iright
BRAND / VENDOR: Proteintech

Proteintech, 84401-4-RR, NeuN Recombinant monoclonal antibody

CATALOG NUMBER: 84401-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NeuN (84401-4-RR) by Proteintech is a Recombinant antibody targeting NeuN in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat, pig samples 84401-4-RR targets NeuN in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, pig brain tissue, rat cerebellum tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue, mouse cerebellum tissue, mouse brain tissue Positive IF-Fro detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:3000-1:12000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species Full Name: hexaribonucleotide binding protein 3 Observed Molecular Weight: 46-52 kDa GenBank Accession Number: NM_001082575 Gene Symbol: NeuN Gene ID (NCBI): 146713 RRID: AB_3671930 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: A6NFN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924