Iright
BRAND / VENDOR: Proteintech

Proteintech, 84445-1-RR, SMURF2 Recombinant monoclonal antibody

CATALOG NUMBER: 84445-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SMURF2 (84445-1-RR) by Proteintech is a Recombinant antibody targeting SMURF2 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84445-1-RR targets SMURF2 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs,TGF-beta receptor,and other substrates.It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression(PMID:22231558).SMURF2 associates constitutively with SMAD7 and it is nuclear, but binding to SMAD7 induces export and recruitment to activated TGFBR, where it causes degradation of receptors and of SMAD7 via proteasomal and lysosomal pathways(PMIF:11163210). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33419 Product name: Recombinant human SMURF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 390-748 aa of BC093876 Sequence: AGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE Predict reactive species Full Name: SMAD specific E3 ubiquitin protein ligase 2 Calculated Molecular Weight: 748 aa, 86 kDa GenBank Accession Number: BC093876 Gene Symbol: SMURF2 Gene ID (NCBI): 64750 RRID: AB_3671970 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9HAU4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924