Iright
BRAND / VENDOR: Proteintech

Proteintech, 84453-1-RR, TGFBR1 Recombinant monoclonal antibody

CATALOG NUMBER: 84453-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TGFBR1 (84453-1-RR) by Proteintech is a Recombinant antibody targeting TGFBR1 in WB, IHC, ELISA applications with reactivity to human samples 84453-1-RR targets TGFBR1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, MDA-MB-231 cells, A549 cells Positive IHC detected in: human lung cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information TGFBR1 (TGF-beta receptor type-1) encodes a serine/threonine kinase receptor for transforming growth factor-beta. TGFB1, TGFB2 and TGFB3 signals are transduced from the cell surface to the cytoplasm and regulate lots of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Mutations in both TGFBR2 and TGFBR1 were associated with early onset and aggressive thoracic aortic disease with MFS-like skeletal features, but also hypertelorism, craniosynostosis, developmental delay, cleft palate and bifid uvula, congenital heart disease and aneurysms, and dissections throughout the arterial tree with marked arterial tortuosity (PMID: 15731757, PMID: 27879313). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31620 Product name: Recombinant human TGFBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-180 aa of NM_004612 Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL Predict reactive species Full Name: transforming growth factor, beta receptor 1 Calculated Molecular Weight: 56KD Observed Molecular Weight: 56 kDa GenBank Accession Number: NM_004612 Gene Symbol: TGFBR1 Gene ID (NCBI): 7046 RRID: AB_3671979 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P36897 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924