Iright
BRAND / VENDOR: Proteintech

Proteintech, 84495-4-RR, LMO7 Recombinant monoclonal antibody

CATALOG NUMBER: 84495-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LMO7 (84495-4-RR) by Proteintech is a Recombinant antibody targeting LMO7 in WB, ELISA applications with reactivity to human samples 84495-4-RR targets LMO7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, A549 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information LMO7, also known as LOMP, FBX20, belongs to the single Calponin-homology (CH) domain-containing protein family, with a single actin-binding CH domain at the amino terminal end(PMID: 19459066). LMO7 also contains a PDZ domain and a carboxyl-terminal LIM domain, both of which have been described as protein-protein interacting domains(PMID: 15140894). LMO7 encodes three splice variants of calculated molecular weights of 196 kDa (P200), 157 kDa (P150), and 100 kDa (P100)(PMID: 26157009). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30016 Product name: Recombinant human LMO7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 695-838 aa of NM_005358 Sequence: KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY Predict reactive species Full Name: LIM domain 7 Calculated Molecular Weight: 193 kDa Observed Molecular Weight: 150 kDa, 180 kDa GenBank Accession Number: NM_005358 Gene Symbol: LMO7 Gene ID (NCBI): 4008 RRID: AB_3672008 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WWI1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924