Proteintech, 84498-1-RR, NDUFA4L2 Recombinant monoclonal antibody

Size: 20ul / 100ul The NDUFA4L2 (84498-1-RR) by Proteintech is a Recombinant antibody targeting NDUFA4L2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 84498-1-RR targets NDUFA4L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, PC-3 cells, human liver tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information NDUFA4L2 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9600 Product name: Recombinant human NDUFA4L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 Calculated Molecular Weight: 87 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC011910 Gene Symbol: NDUFA4L2 Gene ID (NCBI): 56901 RRID: AB_3672011 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NRX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.