Iright
BRAND / VENDOR: Proteintech

Proteintech, 84499-1-RR, TMBIM6 Recombinant monoclonal antibody

CATALOG NUMBER: 84499-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TMBIM6 (84499-1-RR) by Proteintech is a Recombinant antibody targeting TMBIM6 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 84499-1-RR targets TMBIM6 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:125-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24780 Product name: Recombinant human TMBIM6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-86 aa of BC000916 Sequence: MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLG Predict reactive species Full Name: transmembrane BAX inhibitor motif containing 6 Calculated Molecular Weight: 27 kDa GenBank Accession Number: BC000916 Gene Symbol: TMBIM6 Gene ID (NCBI): 7009 RRID: AB_3672012 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P55061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924