Iright
BRAND / VENDOR: Proteintech

Proteintech, 84514-4-RR, LASS2 Recombinant monoclonal antibody

CATALOG NUMBER: 84514-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LASS2 (84514-4-RR) by Proteintech is a Recombinant antibody targeting LASS2 in WB, IHC, ELISA applications with reactivity to human samples 84514-4-RR targets LASS2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293T cells, MCF-7 cells, K-562 cells Positive IHC detected in: Human Hepatocellular cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information LASS2, also known as TMSG1, is a novel suppressor of human cancer metastasis. As one member of LASS family, including LASS1-6, LASS2 mRNA is at the highest level of all LASS members, and has the broadest tissue distribution, particularly abundant in the liver, kidney and brain in mice. The biological roles of LASS2 include protection from aging , hepatic INS resistance, and hepatocellular carcinoma (HCC) progression. LASS2 has been correlated with the degree of invasion and recurrence of carcinomas of the prostate, liver, breast and bladder. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14151 Product name: Recombinant human LASS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 315-380 aa of BC010032 Sequence: LHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKND Predict reactive species Full Name: LAG1 homolog, ceramide synthase 2 Calculated Molecular Weight: 380 aa, 45 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC010032 Gene Symbol: LASS2 Gene ID (NCBI): 29956 RRID: AB_3672021 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96G23 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924