Iright
BRAND / VENDOR: Proteintech

Proteintech, 84532-4-RR, IL-1RA Recombinant monoclonal antibody

CATALOG NUMBER: 84532-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL-1RA (84532-4-RR) by Proteintech is a Recombinant antibody targeting IL-1RA in WB, ELISA applications with reactivity to human samples 84532-4-RR targets IL-1RA in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Interleukin-1 receptor antagonist (IL-1RA) is a critical member of the IL-1 family of cytokines, which plays a significant role in modulating inflammatory responses. IL-1RA exists in two main forms: a secreted form (sIL-1Ra) and an intracellular form (icIL-1Ra). The secreted form is produced by various cells including monocytes, macrophages, neutrophils, and other cells, while the intracellular form is found in keratinocytes and other epithelial cells, as well as in monocytes and fibroblasts. IL-1RA is important in host defense against endotoxin-induced injury and is produced in numerous experimental animal models of disease, as well as in human autoimmune and chronic inflammatory diseases. It acts as an anti-inflammatory agent by maintaining the balance between pro-inflammatory IL-1α/β and its own anti-inflammatory effects. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1277 Product name: Recombinant human IL-1RA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-159 aa of BC009745 Sequence: MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE Predict reactive species Full Name: interleukin 1 receptor antagonist Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 16-18 kDa GenBank Accession Number: BC009745 Gene Symbol: IL-1RA Gene ID (NCBI): 3557 RRID: AB_3672040 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P18510 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924