Proteintech, 84581-3-RR, TRAF2 Recombinant monoclonal antibody

Size: 20ul / 100ul The TRAF2 (84581-3-RR) by Proteintech is a Recombinant antibody targeting TRAF2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 84581-3-RR targets TRAF2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, HepG2 cells, MOLT-4 cells. NIH/3T3 cells, C2C12 cells Positive IHC detected in: human ovary cancer tissue, human rectal cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Tumor necrosis factor (TNF) receptor-associated factor-2 (TRAF2) is one of the members of the TRAF superfamily protein, which is an intracellular junction protein with E3 ligase activity. TRAF2 mediates and regulates the activation of nuclear factor kappa B (NF-κB) and microtubule-associated protein kinase (MAPK) signaling pathways by binding to TNFR family proteins. Recent studies have demonstrated that TRAF2 regulates tumor progression by through multiple pathways. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species Full Name: TNF receptor-associated factor 2 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC032410 Gene Symbol: TRAF2 Gene ID (NCBI): 7186 RRID: AB_3672080 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q12933 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.