Proteintech, 84584-5-RR, BAP31 Recombinant monoclonal antibody

Size: 20ul / 100ul The BAP31 (84584-5-RR) by Proteintech is a Recombinant antibody targeting BAP31 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 84584-5-RR targets BAP31 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HeLa cells, MCF-7 cells, THP-1 cells, mouse liver tissue, rat liver tisssue Positive IHC detected in: human colon cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HepG2 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information BAP31, also known as BCAP31, is a chaperone protein abundant in the endoplasmic reticulum (ER). BAP31 plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded proteins, and their targeting to the ER-associated-degradation (ERAD). CDIP1 and BAP31 interact upon ER stress to regulate the mitochondrial apoptosis pathway(PMID: 24139803). It also serves as a cargo receptor for the export of transmembrane proteins. BAP31 may be involved in apoptosis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1668 Product name: Recombinant human BCAP31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC014323 Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE Predict reactive species Full Name: B-cell receptor-associated protein 31 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC014323 Gene Symbol: BAP31 Gene ID (NCBI): 10134 RRID: AB_3672082 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P51572 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.