Iright
BRAND / VENDOR: Proteintech

Proteintech, 84608-5-RR, EMR2/CD312 Recombinant monoclonal antibody

CATALOG NUMBER: 84608-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EMR2/CD312 (84608-5-RR) by Proteintech is a Recombinant antibody targeting EMR2/CD312 in WB, IF/ICC, ELISA applications with reactivity to human samples 84608-5-RR targets EMR2/CD312 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, THP-1 cells, L02 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information EMR2 (Epidermal Growth Factor-like module-containing Mucin-like Hormone Receptor 2), also known as ADGRE2, is a member of the adhesion-GPCR family that contains extracellular EGF-like domains. EMR2 contains a total of five tandem EGF-like domains and expresses similar protein isoforms consisting of various numbers of EGF-like domains as a result of alternative RNA splicing (PMID: 10903844). EMR2 is restricted to myeloid cells including monocytes, macrophages, dendritic cells and granulocytes28 and its expression is highly regulated during monocyte/macrophage differentiation (PMID: 31969668).The ligation of EMR2 could increase neutrophil adhesion, migration and anti-microbial mediator production and could enhance the systemic inflammation (PMID: 27905560). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2479 Product name: Recombinant Human EMR2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-260 aa of NM_013447.3 Sequence: QDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCE Predict reactive species Full Name: egf-like module containing, mucin-like, hormone receptor-like 2 Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 75~90 kDa GenBank Accession Number: NM_013447.3 Gene Symbol: EMR2 Gene ID (NCBI): 30817 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UHX3-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924