Iright
BRAND / VENDOR: Proteintech

Proteintech, 84613-2-RR, BTD Recombinant monoclonal antibody

CATALOG NUMBER: 84613-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The BTD (84613-2-RR) by Proteintech is a Recombinant antibody targeting BTD in WB, ELISA applications with reactivity to human, mouse samples 84613-2-RR targets BTD in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information BTD(Biotinidase) functions to recycle protein-bound biotin by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in the regeneration of free biotin. BTD has also been shown to have biotinyl transferase activity. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9449 Product name: Recombinant human BTD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-543 aa of BC012099 Sequence: FNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD Predict reactive species Full Name: biotinidase Calculated Molecular Weight: 543 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC012099 Gene Symbol: BTD Gene ID (NCBI): 686 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P43251 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924