Iright
BRAND / VENDOR: Proteintech

Proteintech, 84615-2-RR, PSMA/GCPII Recombinant monoclonal antibody

CATALOG NUMBER: 84615-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PSMA/GCPII (84615-2-RR) by Proteintech is a Recombinant antibody targeting PSMA/GCPII in WB, IF/ICC, ELISA applications with reactivity to human samples 84615-2-RR targets PSMA/GCPII in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells Positive IF/ICC detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Prostate-specific membrane antigen (PSMA), also known as glutamate carboxypeptidase II (GCPII), is a type II transmembrane glycoprotein that has gained significant attention in the field of prostate cancer (PCa) diagnostics and therapeutics. PSMA is highly overexpressed in prostate cancer tissue, especially in aggressive, androgen-deprived, metastatic, and hormone-refractory prostate cancers. Up to 95% of prostate adenocarcinomas express PSMA receptors on their surface. Physiological expression of PSMA is observed in normal prostate epithelium, duodenum, colon, renal tubules, and sympathetic ganglia. It is also found in other tissues such as the salivary glands, lacrimal glands, and various parts of the gastrointestinal tract, though at lower levels. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0216 Product name: Recombinant Human FOLH1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*His Domain: 44-750 aa of NM_004476.3 Sequence: KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA Predict reactive species Full Name: folate hydrolase (prostate-specific membrane antigen) 1 Calculated Molecular Weight: 84KD Observed Molecular Weight: 100 kDa GenBank Accession Number: NM_004476.3 Gene Symbol: PSMA Gene ID (NCBI): 2346 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04609 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924