Iright
BRAND / VENDOR: Proteintech

Proteintech, 84621-3-RR, SPARC Recombinant monoclonal antibody

CATALOG NUMBER: 84621-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SPARC (84621-3-RR) by Proteintech is a Recombinant antibody targeting SPARC in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84621-3-RR targets SPARC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue, A375 cells, human placenta tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SPARC, also known as ON (Osteonectin) or BM-40 (Basement-membrane protein 40), is an extracellular glycoprotein with the calculated molecular mass of 35 kDa and the apparent molecular mass of 40-43 kDa and 50 kDa (PMID: 7495300, 12365801). SPARC belongs to a group of matricellular proteins defined as secreted components that do not contribute directly to the formation of structural elements but serve to modulate cell-matrix interactions and cellular functions (PMID: 7542656; 12231357). SPARC is expressed at high levels in bone tissue, is distributed widely in many other tissues and cell types, and is associated generally with tissues undergoing morphogenesis, remodeling and wound repair (PMID: 10567433). It elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (PMID: 12721366). Altered expression of SPARC has been reported in a variety of cancers, which include breast, ovarian, colorectal, and pancreatic cancer as well as melanoma and glioblastomas (PMID: 18849185). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1169 Product name: Recombinant Human SPARC protein (His Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 18-303 aa of NM_003118.4 Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI Predict reactive species Full Name: secreted protein, acidic, cysteine-rich (osteonectin) Calculated Molecular Weight: 35kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: NM_003118.4 Gene Symbol: SPARC Gene ID (NCBI): 6678 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09486 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924