Iright
BRAND / VENDOR: Proteintech

Proteintech, 84625-3-RR, BLIMP1/PRDM1 Recombinant monoclonal antibody

CATALOG NUMBER: 84625-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The BLIMP1/PRDM1 (84625-3-RR) by Proteintech is a Recombinant antibody targeting BLIMP1/PRDM1 in WB, IF/ICC, ELISA applications with reactivity to human samples 84625-3-RR targets BLIMP1/PRDM1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cell, A431 cells Positive IF/ICC detected in: A549 cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BLIMP1(B lymphocyte-induced maturation protein 1), also known as PRDM1(PR domain zinc finger protein 1), is an evolutionarily conserved transcriptional regulator originally described as a repressor of gene transcription(PMID: 35154079). BLIMP1/PRDM1 is widely expressed in multiple cell types including B lymphocytes, T lymphocytes, mammary luminal progenitor cells and skin epithelial cells. BLIMP1/PRDM1 is a master regulator of terminal B cell differentiation and may also function as a tumor suppressor in the pathogenesis of DLBCL, where it is frequently inactivated by mutations and deletions. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2625 Product name: Recombinant Human PRDM1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 45-230 aa of NM_001198.3 Sequence: DMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQTQSSLKQ Predict reactive species Full Name: PR domain containing 1, with ZNF domain Calculated Molecular Weight: 92 kDa Observed Molecular Weight: 96-110 kDa GenBank Accession Number: NM_001198.3 Gene Symbol: PRDM1 Gene ID (NCBI): 639 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O75626-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924