Iright
BRAND / VENDOR: Proteintech

Proteintech, 84660-4-RR, C3orf37 Recombinant monoclonal antibody

CATALOG NUMBER: 84660-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The C3orf37 (84660-4-RR) by Proteintech is a Recombinant antibody targeting C3orf37 in WB, IF/ICC, ELISA applications with reactivity to human samples 84660-4-RR targets C3orf37 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MCF-7 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information HMCES, also known as C3orf37, is a protein that is associated with the protection of abasic sites. The molecular mass of HMCES is 40 kDa and it recognizes AP sites in ssDNA at replication forks and chemically modifies the lesion to generate a DNA-protein crosslink (PMID: 30554877). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag36362 Product name: Recombinant human C3orf37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-300 aa of BC009993 Sequence: DTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKED Predict reactive species Full Name: chromosome 3 open reading frame 37 Observed Molecular Weight: 39 kDa GenBank Accession Number: BC009993 Gene Symbol: C3orf37 Gene ID (NCBI): 56941 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96FZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924