Proteintech, 84668-2-RR, CEBP Alpha/CEBPA Recombinant monoclonal antibody

Size: 20ul / 100ul The CEBP Alpha/CEBPA (84668-2-RR) by Proteintech is a Recombinant antibody targeting CEBP Alpha/CEBPA in WB, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human samples 84668-2-RR targets CEBP Alpha/CEBPA in WB, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, U-937 cells, HL-60 cells Positive FC (Intra) detected in: HeLa cells, HepG2 cells Positive ChIP-qPCR detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information CEBPA and its isoforms play important roles in lineage determination and gene activation in a variety of cell types by activating transcription from lineage-specific promoters. CEBPA is a DNA-binding protein that recognizes two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. In hematopoiesis, C/EBPa is a key factor in driving the development of myeloid cells interacting with a variety of factors, including c-Myc, PU.1, and microRNAs. It can also form heterodimers with the related proteins CEBP-beta and CEBP-gamma. The encoded protein has been shown to bind to the promoter and modulate the expression of the gene encoding leptin which plays an important role in body weight homeostasis. CEBPA can interact with CDK2 and CDK4, thereby inhibiting these kinases and causing growth arrest in cultured cells. Several pathways have been implicated as the means by which CEBPA mediates cell cycle arrest and proliferation, including p21, cyclin-dependent kinases and the E2F complex via c-Myc. The calcualted molecular weight of CEBPA is 38 kDa, but modified CEBPA is about 42 kDa (PMID: 19623175). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29947 Product name: Recombinant human CEBPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of NM_004364 Sequence: MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAH Predict reactive species Full Name: CCAAT/enhancer binding protein (C/EBP), alpha Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: NM_004364 Gene Symbol: CEBPA Gene ID (NCBI): 1050 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49715 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.