Iright
BRAND / VENDOR: Proteintech

Proteintech, 84671-4-RR, DIAPH2 Recombinant monoclonal antibody

CATALOG NUMBER: 84671-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DIAPH2 (84671-4-RR) by Proteintech is a Recombinant antibody targeting DIAPH2 in WB, ELISA applications with reactivity to human samples 84671-4-RR targets DIAPH2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293T cells, HeLa cells, Jurkat cells, MCF-7 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information In vertebrates, three DRF genes (DIAPH1, DIAPH2 and DIAPH3) are the orthologs of the Drosophila melanogaster diaphanous (dia) gene, which has important roles in fertility and hearing in the fly. DIAPH1 and DIAPH3 have been associated with different types of hearing loss (HL). DIAPH2, located on chromosome Xq21.33, until now it has only been linked to premature ovarian failure 2 (POF2A). (PMID: 36689403) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35280 Product name: Recombinant human DIAPH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-146 aa of NM_006729.4 Sequence: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT Predict reactive species Full Name: diaphanous homolog 2 (Drosophila) Calculated Molecular Weight: 126kDa Observed Molecular Weight: 126-130 kDa GenBank Accession Number: NM_006729.4 Gene Symbol: DIAPH2 Gene ID (NCBI): 1730 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O60879 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924