Proteintech, 84680-4-RR, ERMN Recombinant monoclonal antibody

Size: 20ul / 100ul The ERMN (84680-4-RR) by Proteintech is a Recombinant antibody targeting ERMN in WB, ELISA applications with reactivity to human, rat samples 84680-4-RR targets ERMN in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ERMN is associated with cytoskeletal rearrangements and the stability of myelin sheath. A study has shown that ERMN is expressed specifically in oligodendrocytes in the central nervous system (CNS), and is involved in the formation of myelin (PMID: 20934411). The predicted MW of ERMN is 33 KDa, while western blot analyses detected a 50 kDa single band protein as a result of phosphorylation modification. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35648 Product name: Recombinant human ERMN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC026345 Sequence: MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSR Predict reactive species Full Name: ermin, ERM-like protein Observed Molecular Weight: 50 kDa GenBank Accession Number: BC026345 Gene Symbol: ERMN Gene ID (NCBI): 57471 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8TAM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.