Proteintech, 84690-1-RR, NRCAM Recombinant monoclonal antibody

Size: 20ul / 100ul The NRCAM (84690-1-RR) by Proteintech is a Recombinant antibody targeting NRCAM in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 84690-1-RR targets NRCAM in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Neuronal cell adhesion molecule (NRCAM) is a member of the L1 subfamily of cell adhesion molecules (CAMs) that belong to the immunoglobulin superfamily (PMID: 11329126). NRCAM is a transmembrane protein composed of six Ig-like domains and five fibronectin type-III repeats in the extracellular region, with a highly conserved cytoplasmic tail. It is mainly expressed in the nervous system and is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM is also expressed outside the nervous system. Altered expression of NRCAM has been associated with tumor progression in diverse organs (PMID: 22182708). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16237 Product name: Recombinant human NRCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-628 aa of BC098401 Sequence: EPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDATWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAVLSVV Predict reactive species Full Name: neuronal cell adhesion molecule Calculated Molecular Weight: 1304 aa, 144 kDa Observed Molecular Weight: 144 kDa GenBank Accession Number: BC098401 Gene Symbol: NRCAM Gene ID (NCBI): 4897 RRID: AB_3672106 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q92823 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.