Iright
BRAND / VENDOR: Proteintech

Proteintech, 84714-2-RR, WASP Recombinant monoclonal antibody

CATALOG NUMBER: 84714-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The WASP (84714-2-RR) by Proteintech is a Recombinant antibody targeting WASP in WB, ELISA applications with reactivity to human samples 84714-2-RR targets WASP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, TF-1 cells, HL-60 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Wiskott-Aldrich Syndrome protein (WASP) regulates actin cytoskeleton in hematopoietic cells and defects in WASP cause Wiskott-Aldrich Syndrome (WAS), an X-linked immunodeficiency and autoimmunity disorder of childhood. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1444 Product name: Recombinant human WAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC012738 Sequence: MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPP Predict reactive species Full Name: Wiskott-Aldrich syndrome (eczema-thrombocytopenia) Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC012738 Gene Symbol: WASP Gene ID (NCBI): 7454 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42768 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924