Proteintech, 84754-5-RR, BTLA/CD272 Recombinant monoclonal antibody

Size: 20ul / 100ul The BTLA/CD272 (84754-5-RR) by Proteintech is a Recombinant antibody targeting BTLA/CD272 in WB, IF/ICC, ELISA applications with reactivity to mouse samples 84754-5-RR targets BTLA/CD272 in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse thymus tissue Positive IF/ICC detected in: A20 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information BTLA, or B and T lymphocyte attenuator, is a member of the CD28 superfamily and is a type I membrane glycoprotein identified as an inhibitory receptor (PMID: 33859648). BTLA is extensively expressed in lymph nodes, thymus, and spleen, with little or no expression in organs such as the heart, kidney, brain, and liver (PMID: 33859648). Among immune cells, BTLA is primarily expressed in B and T cells, with higher expression in B cells compared to T cells in the mouse spleen (PMID: 33859648). BTLA plays a crucial role in regulating stimulatory and inhibitory signals in immune responses. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1843 Product name: Recombinant Mouse BTLA protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-176 aa of AAI08964.1 Sequence: EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG Predict reactive species Full Name: B and T lymphocyte associated Calculated Molecular Weight: 34kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: AAI08964.1 Gene Symbol: Btla Gene ID (NCBI): 208154 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q32MV9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.