Iright
BRAND / VENDOR: Proteintech

Proteintech, 84759-4-RR, CLIC3 Recombinant monoclonal antibody

CATALOG NUMBER: 84759-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CLIC3 (84759-4-RR) by Proteintech is a Recombinant antibody targeting CLIC3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84759-4-RR targets CLIC3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: JAR cells, HeLa cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume (PMID: 9880541). CLIC3 (chloride intracellular channel protein 3) belongs to the chloride channel CLIC family which has seven members based on sequence homology to the p64 chloride channels of bovine kidney microsomes. CLIC proteins lack the membrane-spanning domains characteristic of channel proteins and are largely intracellular. CLIC3 is predominantly localized in the nucleus and has a high expression level in placenta (PMID: 9880541; 17027078). It associates with the C-terminal of ERK7 and may participate in cellular growth control. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8757 Product name: Recombinant human CLIC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC007012 Sequence: MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR Predict reactive species Full Name: chloride intracellular channel 3 Calculated Molecular Weight: 236 aa, 26 kDa Observed Molecular Weight: 27-32 kDa GenBank Accession Number: BC007012 Gene Symbol: CLIC3 Gene ID (NCBI): 9022 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O95833 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924